Lineage for d3csua1 (3csu A:1-150)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139045Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2139046Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2139047Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 protein domains)
  6. 2139048Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2139056Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
    Uniprot P00479
  8. 2139063Domain d3csua1: 3csu A:1-150 [35094]
    complexed with ca

Details for d3csua1

PDB Entry: 3csu (more details), 1.88 Å

PDB Description: catalytic trimer of escherichia coli aspartate transcarbamoylase
PDB Compounds: (A:) protein (aspartate carbamoyltransferase)

SCOPe Domain Sequences for d3csua1:

Sequence, based on SEQRES records: (download)

>d3csua1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Sequence, based on observed residues (ATOM records): (download)

>d3csua1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsgkkgetladtisvistyvdaivmrhpqegaarlatefsgnvpvl
nagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d3csua1:

Click to download the PDB-style file with coordinates for d3csua1.
(The format of our PDB-style files is described here.)

Timeline for d3csua1: