Lineage for d5vjda_ (5vjd A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. Family c.1.10.2: Class II FBP aldolase [51591] (3 proteins)
    metal-dependent
    automatically mapped to Pfam PF01116
  6. Protein Fructose-bisphosphate aldolase (FBP aldolase) [51592] (3 species)
  7. Species Escherichia coli [TaxId:83333] [336437] (8 PDB entries)
  8. Domain d5vjda_: 5vjd A: [350931]
    automated match to d1gyna_
    complexed with 13p, na, zn

Details for d5vjda_

PDB Entry: 5vjd (more details), 1.7000000000000002 Å

PDB Description: class ii fructose-1,6-bisphosphate aldolase of escherichia coli with dhap
PDB Compounds: (A:) Fructose-bisphosphate aldolase class 2

SCOPe Domain Sequences for d5vjda_:

Sequence, based on SEQRES records: (download)

>d5vjda_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 83333]}
skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpti
lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl

Sequence, based on observed residues (ATOM records): (download)

>d5vjda_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 83333]}
skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
ytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltptilrdsqeyvskkhnlp
hnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlg
npkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl

SCOPe Domain Coordinates for d5vjda_ are not available.

Timeline for d5vjda_:

Domains from other chains:
(mouse over for more information)
d5vjdb_