Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.0: automated matches [191662] (1 protein) not a true family |
Protein automated matches [191250] (6 species) not a true protein |
Species Paraburkholderia phymatum [TaxId:391038] [350810] (1 PDB entry) |
Domain d6cv6h_: 6cv6 H: [350930] Other proteins in same PDB: d6cv6b2, d6cv6c2, d6cv6e2, d6cv6i2 automated match to d1uqra_ complexed with cl, tar, tla |
PDB Entry: 6cv6 (more details), 2.6 Å
SCOPe Domain Sequences for d6cv6h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cv6h_ c.23.13.0 (H:) automated matches {Paraburkholderia phymatum [TaxId: 391038]} mkkvlmlhginhnmfgkrdpvqygtitlseidnrlqalaaelgvqvesfqtnsegamcer ihqafeercdavlinagawthysygirdalailtcpvvelhmsnvharepfrhhsvfsev vvgqicgfgmesyllalraavaqsg
Timeline for d6cv6h_: