Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
Family d.58.56.1: CcmK-like [143415] (4 proteins) Pfam PF00936; BMC domain |
Protein automated matches [191074] (7 species) not a true protein |
Species Halothece sp. [TaxId:65093] [350926] (1 PDB entry) |
Domain d5vgue_: 5vgu E: [350927] automated match to d2a10a1 |
PDB Entry: 5vgu (more details), 1.81 Å
SCOPe Domain Sequences for d5vgue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vgue_ d.58.56.1 (E:) automated matches {Halothece sp. [TaxId: 65093]} sldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamdag ihavdkaygaaletwviiprphenvecvlpiaynenverfr
Timeline for d5vgue_: