Lineage for d5vgue_ (5vgu E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955934Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2955935Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 2955969Protein automated matches [191074] (7 species)
    not a true protein
  7. 2955970Species Halothece sp. [TaxId:65093] [350926] (1 PDB entry)
  8. 2955975Domain d5vgue_: 5vgu E: [350927]
    automated match to d2a10a1

Details for d5vgue_

PDB Entry: 5vgu (more details), 1.81 Å

PDB Description: structure of halothece sp. pcc 7418 ccmk4
PDB Compounds: (E:) Microcompartments protein

SCOPe Domain Sequences for d5vgue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vgue_ d.58.56.1 (E:) automated matches {Halothece sp. [TaxId: 65093]}
sldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamdag
ihavdkaygaaletwviiprphenvecvlpiaynenverfr

SCOPe Domain Coordinates for d5vgue_:

Click to download the PDB-style file with coordinates for d5vgue_.
(The format of our PDB-style files is described here.)

Timeline for d5vgue_: