SCOPe 2.07: Domain d5vfab2: 5vfa B:135-229

Lineage for d5vfab2 (5vfa B:135-229)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (24 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:171101] [350919] (1 PDB entry)

8. Domain d5vfab2: 5vfa B:135-229 [350920]
   Other proteins in same PDB: d5vfaa1, d5vfaa3, d5vfab1, d5vfab3
   automated match to d1kgsa1
   mutant

Details for d5vfab2

PDB Entry: 5vfa, 1.45 Å

PDB Description: ritr mutant - c128d

PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d5vfab2:

Sequence; same for both SEQRES and ATOM records:

>d5vfab2 a.4.6.0 (B:135-229) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
rtyrnlridvehhtvyrgeemialtrreydllatlmgskkvltreqllesvwkyesatet
nivdvyirylrskldvkgqksyiktvrgvgytmqe

Timeline for d5vfab2:

• d5vfab2 is new in SCOPe 2.07-stable
  
• d5vfab2 appears in the current release, SCOPe 2.08