Lineage for d1ekxc1 (1ekx C:1-150)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27322Fold c.78: ATC-like [53670] (2 superfamilies)
  4. 27323Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 27324Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)
  6. 27325Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)
  7. 27333Species Escherichia coli [TaxId:562] [53674] (27 PDB entries)
  8. 27338Domain d1ekxc1: 1ekx C:1-150 [35092]

Details for d1ekxc1

PDB Entry: 1ekx (more details), 1.95 Å

PDB Description: the isolated, unregulated catalytic trimer of aspartate transcarbamoylase complexed with bisubstrate analog pala (n-(phosphonacetyl)-l-aspartate)

SCOP Domain Sequences for d1ekxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekxc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOP Domain Coordinates for d1ekxc1:

Click to download the PDB-style file with coordinates for d1ekxc1.
(The format of our PDB-style files is described here.)

Timeline for d1ekxc1: