Lineage for d1ekxc1 (1ekx C:1-150)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
    Uniprot P00479
  8. Domain d1ekxc1: 1ekx C:1-150 [35092]
    complexed with ca, pal

Details for d1ekxc1

PDB Entry: 1ekx (more details), 1.95 Å

PDB Description: the isolated, unregulated catalytic trimer of aspartate transcarbamoylase complexed with bisubstrate analog pala (n-(phosphonacetyl)-l-aspartate)
PDB Compounds: (C:) aspartate transcarbamoylase

SCOPe Domain Sequences for d1ekxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekxc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d1ekxc1 are not available.

Timeline for d1ekxc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ekxc2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ekxa1, d1ekxa2, d1ekxb1, d1ekxb2