Lineage for d5vfab1 (5vfa B:2-127)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464395Species Streptococcus pneumoniae [TaxId:171101] [226388] (3 PDB entries)
  8. 2464399Domain d5vfab1: 5vfa B:2-127 [350918]
    Other proteins in same PDB: d5vfaa2, d5vfaa3, d5vfab2, d5vfab3
    automated match to d1kgsa2
    mutant

Details for d5vfab1

PDB Entry: 5vfa (more details), 1.45 Å

PDB Description: ritr mutant - c128d
PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d5vfab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vfab1 c.23.1.0 (B:2-127) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
gkrilllekernlahflslelqkeqyrvdlveegqkalsmalqtdydlillnvnlgdmma
qdfaeklsrtkpasvimildhwedlqeelevvqrfavsyiykpvlienlvarisaifrgr
dfidqh

SCOPe Domain Coordinates for d5vfab1:

Click to download the PDB-style file with coordinates for d5vfab1.
(The format of our PDB-style files is described here.)

Timeline for d5vfab1: