SCOPe 2.07: Domain d5vfab1: 5vfa B:2-127

Lineage for d5vfab1 (5vfa B:2-127)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (84 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:171101] [226388] (3 PDB entries)

8. Domain d5vfab1: 5vfa B:2-127 [350918]
   Other proteins in same PDB: d5vfaa2, d5vfaa3, d5vfab2, d5vfab3
   automated match to d1kgsa2
   mutant

Details for d5vfab1

PDB Entry: 5vfa, 1.45 Å

PDB Description: ritr mutant - c128d

PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d5vfab1:

Sequence; same for both SEQRES and ATOM records:

>d5vfab1 c.23.1.0 (B:2-127) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
gkrilllekernlahflslelqkeqyrvdlveegqkalsmalqtdydlillnvnlgdmma
qdfaeklsrtkpasvimildhwedlqeelevvqrfavsyiykpvlienlvarisaifrgr
dfidqh

Timeline for d5vfab1:

• d5vfab1 is new in SCOPe 2.07-stable
  
• d5vfab1 appears in the current release, SCOPe 2.08