Lineage for d5ucnb_ (5ucn B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444973Species Helicobacter pylori [TaxId:85962] [312431] (15 PDB entries)
  8. 2444987Domain d5ucnb_: 5ucn B: [350915]
    automated match to d3c4ua_
    complexed with 13p, na, zn

Details for d5ucnb_

PDB Entry: 5ucn (more details), 1.67 Å

PDB Description: class ii fructose-1,6-bisphosphate aldolase e142a variant of helicobacter pylori with dhap
PDB Compounds: (B:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d5ucnb_:

Sequence, based on SEQRES records: (download)

>d5ucnb_ c.1.10.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgrlmgiadnisvdekdavlvnpkeaeqfvkesqvdylapaigtsh
gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
lgsanki

Sequence, based on observed residues (ATOM records): (download)

>d5ucnb_ c.1.10.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgrvlvnpkeaeqfvkesqvdylapaigtshgafkfkgepkldfer
lqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfeflqesvkgginkvntd
tdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkllgsanki

SCOPe Domain Coordinates for d5ucnb_:

Click to download the PDB-style file with coordinates for d5ucnb_.
(The format of our PDB-style files is described here.)

Timeline for d5ucnb_: