Lineage for d5ud4a_ (5ud4 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444973Species Helicobacter pylori [TaxId:85962] [312431] (15 PDB entries)
  8. 2444980Domain d5ud4a_: 5ud4 A: [350909]
    automated match to d3c4ua_
    complexed with na, p6t, zn

Details for d5ud4a_

PDB Entry: 5ud4 (more details), 1.5 Å

PDB Description: class ii fructose-1,6-bisphosphate aldolase h180q variant of helicobacter pylori with tbp
PDB Compounds: (A:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d5ud4a_:

Sequence, based on SEQRES records: (download)

>d5ud4a_ c.1.10.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgrlmgiednisvdekdavlvnpkeaeqfvkesqvdylapaigtsq
gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
lgsanki

Sequence, based on observed residues (ATOM records): (download)

>d5ud4a_ c.1.10.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgrlvlvnpkeaeqfvkesqvdylapaigtsqgafkfkgepkldfe
rlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfeflqesvkgginkvnt
dtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkllgsanki

SCOPe Domain Coordinates for d5ud4a_:

Click to download the PDB-style file with coordinates for d5ud4a_.
(The format of our PDB-style files is described here.)

Timeline for d5ud4a_: