Lineage for d1ekxb1 (1ekx B:1-150)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2513850Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2513851Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2513859Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
    Uniprot P00479
  8. 2513862Domain d1ekxb1: 1ekx B:1-150 [35090]
    complexed with ca, pal

Details for d1ekxb1

PDB Entry: 1ekx (more details), 1.95 Å

PDB Description: the isolated, unregulated catalytic trimer of aspartate transcarbamoylase complexed with bisubstrate analog pala (n-(phosphonacetyl)-l-aspartate)
PDB Compounds: (B:) aspartate transcarbamoylase

SCOPe Domain Sequences for d1ekxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekxb1 c.78.1.1 (B:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d1ekxb1:

Click to download the PDB-style file with coordinates for d1ekxb1.
(The format of our PDB-style files is described here.)

Timeline for d1ekxb1: