SCOP 1.59: Domain d1ekxb1: 1ekx B:1-150

Lineage for d1ekxb1 (1ekx B:1-150)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)

7. Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)

8. Domain d1ekxb1: 1ekx B:1-150 [35090]

Details for d1ekxb1

PDB Entry: 1ekx, 1.95 Å

PDB Description: the isolated, unregulated catalytic trimer of aspartate transcarbamoylase complexed with bisubstrate analog pala (n-(phosphonacetyl)-l-aspartate)

SCOP Domain Sequences for d1ekxb1:

Sequence; same for both SEQRES and ATOM records:

>d1ekxb1 c.78.1.1 (B:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d1ekxb1:

• d1ekxb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ekxb1 appears in SCOP 1.57
  
• d1ekxb1 appears in SCOP 1.61
  
• d1ekxb1 appears in the current release, SCOPe 2.08