![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) ![]() |
![]() | Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
![]() | Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [350889] (2 PDB entries) |
![]() | Domain d6g4qa2: 6g4q A:171-345 [350890] Other proteins in same PDB: d6g4qa1, d6g4qa3 automated match to d1euda2 complexed with edo, nep |
PDB Entry: 6g4q (more details), 2.59 Å
SCOPe Domain Sequences for d6g4qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g4qa2 c.23.4.1 (A:171-345) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp fngtdfidcleiflndsategiiligeiggnaeenaaeflkqhnsgpnskpvvsfiaglt appgrrmghagaiiaggkggakekisalqsagvvvsmspaqlgttiykefekrkm
Timeline for d6g4qa2: