Lineage for d6g4qa1 (6g4q A:42-170)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845549Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 2845567Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (6 species)
  7. 2845595Species Human (Homo sapiens) [TaxId:9606] [350887] (2 PDB entries)
  8. 2845597Domain d6g4qa1: 6g4q A:42-170 [350888]
    Other proteins in same PDB: d6g4qa2, d6g4qa3
    automated match to d1euda1
    complexed with edo, nep

Details for d6g4qa1

PDB Entry: 6g4q (more details), 2.59 Å

PDB Description: structure of human adp-forming succinyl-coa ligase complex suclg1- sucla2
PDB Compounds: (A:) Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial

SCOPe Domain Sequences for d6g4qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g4qa1 c.2.1.8 (A:42-170) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Human (Homo sapiens) [TaxId: 9606]}
sytasrqhlyvdkntkiicqgftgkqgtfhsqqaleygtklvggttpgkggqthlglpvf
ntvkeakeqtgatasviyvpppfaaaaineaieaeiplvvcitegipqqdmvrvkhkllr
qektrligp

SCOPe Domain Coordinates for d6g4qa1:

Click to download the PDB-style file with coordinates for d6g4qa1.
(The format of our PDB-style files is described here.)

Timeline for d6g4qa1: