Lineage for d6ezpa_ (6ezp A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2498051Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2498052Protein automated matches [190230] (21 species)
    not a true protein
  7. 2498073Species Human (Homo sapiens) [TaxId:9606] [187072] (48 PDB entries)
  8. 3050824Domain d6ezpa_: 6ezp A: [350886]
    automated match to d2xu3a_
    complexed with c3e, gol

Details for d6ezpa_

PDB Entry: 6ezp (more details), 1.37 Å

PDB Description: cathepsin l in complex with (3s,14e)-19-chloro-n-(1-cyanocyclopropyl)- 5-oxo-12,17-dioxa-4-azatricyclo[16.2.2.06,11]docosa-1(21),6(11),7,9, 14,18(22),19-heptaene-3-carboxamide
PDB Compounds: (A:) Cathepsin L1

SCOPe Domain Sequences for d6ezpa_:

Sequence, based on SEQRES records: (download)

>d6ezpa_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Sequence, based on observed residues (ATOM records): (download)

>d6ezpa_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestnnkyw
lvknswgeewgmggyvkmakdrrnhcgiasaasyptv

SCOPe Domain Coordinates for d6ezpa_:

Click to download the PDB-style file with coordinates for d6ezpa_.
(The format of our PDB-style files is described here.)

Timeline for d6ezpa_:

  • d6ezpa_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-12