![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins) |
![]() | Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [53674] (27 PDB entries) |
![]() | Domain d1ekxa1: 1ekx A:1-150 [35088] |
PDB Entry: 1ekx (more details), 1.95 Å
SCOP Domain Sequences for d1ekxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ekxa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli} anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg nvpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d1ekxa1:
![]() Domains from other chains: (mouse over for more information) d1ekxb1, d1ekxb2, d1ekxc1, d1ekxc2 |