Lineage for d6fc5a1 (6fc5 A:1-82)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394495Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2394561Family b.34.10.0: automated matches [227283] (1 protein)
    not a true family
  6. 2394562Protein automated matches [227098] (2 species)
    not a true protein
  7. 2394563Species Saccharomyces cerevisiae [TaxId:4932] [350860] (1 PDB entry)
  8. 2394564Domain d6fc5a1: 6fc5 A:1-82 [350861]
    Other proteins in same PDB: d6fc5a2
    automated match to d2e4ha_

Details for d6fc5a1

PDB Entry: 6fc5 (more details), 1.88 Å

PDB Description: bik1 cap-gly domain
PDB Compounds: (A:) Microtubule-associated protein

SCOPe Domain Sequences for d6fc5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fc5a1 b.34.10.0 (A:1-82) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
mdryqrkigcfiqipnlgrgqlkyvgpvdtkagmfagvdllanigkndgsfmgkkyfqte
ypqsglfiqlqkvasliekasi

SCOPe Domain Coordinates for d6fc5a1:

Click to download the PDB-style file with coordinates for d6fc5a1.
(The format of our PDB-style files is described here.)

Timeline for d6fc5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fc5a2