SCOPe 2.08: Domain d6fc5a1: 6fc5 A:1-82

Lineage for d6fc5a1 (6fc5 A:1-82)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.10: Cap-Gly domain [74924] (2 families)

5. Family b.34.10.0: automated matches [227283] (1 protein)
   not a true family

6. Protein automated matches [227098] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [350860] (1 PDB entry)

8. Domain d6fc5a1: 6fc5 A:1-82 [350861]
   Other proteins in same PDB: d6fc5a2
   automated match to d2e4ha_

Details for d6fc5a1

PDB Entry: 6fc5, 1.88 Å

PDB Description: bik1 cap-gly domain

PDB Compounds: (A:) Microtubule-associated protein

SCOPe Domain Sequences for d6fc5a1:

Sequence; same for both SEQRES and ATOM records:

>d6fc5a1 b.34.10.0 (A:1-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdryqrkigcfiqipnlgrgqlkyvgpvdtkagmfagvdllanigkndgsfmgkkyfqte
ypqsglfiqlqkvasliekasi

Timeline for d6fc5a1:

• d6fc5a1 first appeared in SCOPe 2.07