Lineage for d6fc5a1 (6fc5 A:1-82)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. Family b.34.10.0: automated matches [227283] (1 protein)
    not a true family
  6. Protein automated matches [227098] (2 species)
    not a true protein
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [350860] (1 PDB entry)
  8. Domain d6fc5a1: 6fc5 A:1-82 [350861]
    Other proteins in same PDB: d6fc5a2
    automated match to d2e4ha_

Details for d6fc5a1

PDB Entry: 6fc5 (more details), 1.8800000000000001 Å

PDB Description: bik1 cap-gly domain
PDB Compounds: (A:) Microtubule-associated protein

SCOPe Domain Sequences for d6fc5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fc5a1 b.34.10.0 (A:1-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdryqrkigcfiqipnlgrgqlkyvgpvdtkagmfagvdllanigkndgsfmgkkyfqte
ypqsglfiqlqkvasliekasi

SCOPe Domain Coordinates for d6fc5a1 are not available.

Timeline for d6fc5a1:

Domains from same chain:
(mouse over for more information)
d6fc5a2