Lineage for d6ep6b1 (6ep6 B:4-83)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880382Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)
  8. 2880388Domain d6ep6b1: 6ep6 B:4-83 [350853]
    Other proteins in same PDB: d6ep6a2, d6ep6b2
    automated match to d5g5aa1
    complexed with gol, mg

Details for d6ep6b1

PDB Entry: 6ep6 (more details), 1.59 Å

PDB Description: arabidopsis thaliana gstu23, reduced
PDB Compounds: (B:) Glutathione S-transferase U23

SCOPe Domain Sequences for d6ep6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ep6b1 c.47.1.0 (B:4-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eiilldywasmygmrtrialeekkvkyeyreedlsnksplllqmnpihkkipvlihegkp
icesiiqvqyidelwpdtnp

SCOPe Domain Coordinates for d6ep6b1:

Click to download the PDB-style file with coordinates for d6ep6b1.
(The format of our PDB-style files is described here.)

Timeline for d6ep6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ep6b2