SCOPe 2.08: Domain d6ep6b1: 6ep6 B:4-83

Lineage for d6ep6b1 (6ep6 B:4-83)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)

8. Domain d6ep6b1: 6ep6 B:4-83 [350853]
   Other proteins in same PDB: d6ep6a2, d6ep6b2
   automated match to d5g5aa1
   complexed with gol, mg

Details for d6ep6b1

PDB Entry: 6ep6, 1.59 Å

PDB Description: arabidopsis thaliana gstu23, reduced

PDB Compounds: (B:) Glutathione S-transferase U23

SCOPe Domain Sequences for d6ep6b1:

Sequence; same for both SEQRES and ATOM records:

>d6ep6b1 c.47.1.0 (B:4-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eiilldywasmygmrtrialeekkvkyeyreedlsnksplllqmnpihkkipvlihegkp
icesiiqvqyidelwpdtnp

Timeline for d6ep6b1:

• d6ep6b1 first appeared in SCOPe 2.07