SCOPe 2.07: Domain d6cxma_: 6cxm A:

Lineage for d6cxma_ (6cxm A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (27 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [350836] (1 PDB entry)

8. Domain d6cxma_: 6cxm A: [350837]
   automated match to d3tqaa_
   complexed with mmv, nap

Details for d6cxma_

PDB Entry: 6cxm, 2.65 Å

PDB Description: crystal structure of a dihydrofolate reductase from mycobacterium smegmatis in complex with nadp and p218

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d6cxma_:

Sequence; same for both SEQRES and ATOM records:

>d6cxma_ c.71.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
smrliwaqstsgiigrdnsipwrlpedlarfkemtmghpvvmgrltweslpasvrplpgr
rnivvtrdadyraegaevvtdlpdepdawviggaqiyamalaradrcevtevdialtpld
gdarapvlddswvattgewqtstsglrfrfcsyrr

Timeline for d6cxma_:

• d6cxma_ is new in SCOPe 2.07-stable
  
• d6cxma_ appears in the current release, SCOPe 2.08