Lineage for d6cxma_ (6cxm A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2477518Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2477519Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2477974Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2477975Protein automated matches [190777] (27 species)
    not a true protein
  7. 3050774Species Mycobacterium smegmatis [TaxId:246196] [350836] (1 PDB entry)
  8. 3050775Domain d6cxma_: 6cxm A: [350837]
    automated match to d3tqaa_
    complexed with mmv, nap

Details for d6cxma_

PDB Entry: 6cxm (more details), 2.65 Å

PDB Description: crystal structure of a dihydrofolate reductase from mycobacterium smegmatis in complex with nadp and p218
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d6cxma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cxma_ c.71.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
smrliwaqstsgiigrdnsipwrlpedlarfkemtmghpvvmgrltweslpasvrplpgr
rnivvtrdadyraegaevvtdlpdepdawviggaqiyamalaradrcevtevdialtpld
gdarapvlddswvattgewqtstsglrfrfcsyrr

SCOPe Domain Coordinates for d6cxma_:

Click to download the PDB-style file with coordinates for d6cxma_.
(The format of our PDB-style files is described here.)

Timeline for d6cxma_:

  • d6cxma_ is new in SCOPe 2.07-stable