Lineage for d6ekif_ (6eki F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2402282Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2402283Protein automated matches [191011] (16 species)
    not a true protein
  7. 3050771Species Persephonella marina [TaxId:309805] [350833] (1 PDB entry)
  8. 3050772Domain d6ekif_: 6eki F: [350834]
    automated match to d4coqb_
    complexed with zn

Details for d6ekif_

PDB Entry: 6eki (more details), 2.56 Å

PDB Description: structure of a hyperthermostable carbonic anhydrase identified from an active hydrothermal vent chimney
PDB Compounds: (F:) carbonic anhydrase

SCOPe Domain Sequences for d6ekif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ekif_ b.74.1.0 (F:) automated matches {Persephonella marina [TaxId: 309805]}
hwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssitnng
htikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnlavigv
ifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcsegvr
wivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd

SCOPe Domain Coordinates for d6ekif_:

Click to download the PDB-style file with coordinates for d6ekif_.
(The format of our PDB-style files is described here.)

Timeline for d6ekif_:

  • d6ekif_ is new in SCOPe 2.07-stable