Lineage for d1bl5__ (1bl5 -)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 249486Fold c.77: Isocitrate/Isopropylmalate dehydrogenases [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudodyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 249487Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenases [53659] (2 families) (S)
  5. 249488Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
    the active site is between the two identical subunits
  6. 249528Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)
  7. 249532Species Escherichia coli [TaxId:562] [53669] (23 PDB entries)
  8. 249551Domain d1bl5__: 1bl5 - [35083]
    complexed with akg, mg, nap

Details for d1bl5__

PDB Entry: 1bl5 (more details), 2.5 Å

PDB Description: isocitrate dehydrogenase from e. coli single turnover laue structure of rate-limited product complex, 10 msec time resolution

SCOP Domain Sequences for d1bl5__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bl5__ c.77.1.1 (-) Isocitrate dehydrogenase, ICDH {Escherichia coli}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

SCOP Domain Coordinates for d1bl5__:

Click to download the PDB-style file with coordinates for d1bl5__.
(The format of our PDB-style files is described here.)

Timeline for d1bl5__: