Lineage for d6et57_ (6et5 7:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021592Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 3021593Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 3021656Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 3021657Protein automated matches [254444] (10 species)
    not a true protein
  7. 3021658Species Blastochloris viridis [TaxId:1079] [350827] (1 PDB entry)
  8. 3021663Domain d6et57_: 6et5 7: [350829]
    Other proteins in same PDB: d6et5c_, d6et5h1, d6et5h2, d6et5m_
    automated match to d1wrga_
    complexed with bcb, bpb, fe, hem, lda, mq9, ns0, ns5, so4, uq9

Details for d6et57_

PDB Entry: 6et5 (more details), 3 Å

PDB Description: reaction centre light harvesting complex 1 from blc. virids
PDB Compounds: (7:) Light-harvesting protein B-1015 beta chain

SCOPe Domain Sequences for d6et57_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6et57_ f.3.1.0 (7:) automated matches {Blastochloris viridis [TaxId: 1079]}
adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv

SCOPe Domain Coordinates for d6et57_:

Click to download the PDB-style file with coordinates for d6et57_.
(The format of our PDB-style files is described here.)

Timeline for d6et57_: