Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
Protein automated matches [254444] (10 species) not a true protein |
Species Blastochloris viridis [TaxId:1079] [350827] (1 PDB entry) |
Domain d6et57_: 6et5 7: [350829] Other proteins in same PDB: d6et5c_, d6et5h1, d6et5h2, d6et5m_ automated match to d1wrga_ complexed with bcb, bpb, fe, hem, lda, mq9, ns0, ns5, so4, uq9 |
PDB Entry: 6et5 (more details), 3 Å
SCOPe Domain Sequences for d6et57_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6et57_ f.3.1.0 (7:) automated matches {Blastochloris viridis [TaxId: 1079]} adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
Timeline for d6et57_:
View in 3D Domains from other chains: (mouse over for more information) d6et51_, d6et53_, d6et54_, d6et56_, d6et5b_, d6et5c_, d6et5e_, d6et5f_, d6et5g_, d6et5h1, d6et5h2, d6et5i_, d6et5k_, d6et5l_, d6et5m_, d6et5n_, d6et5o_, d6et5p_, d6et5q_, d6et5r_, d6et5s_, d6et5t_, d6et5u_, d6et5v_, d6et5w_, d6et5x_, d6et5y_, d6et5z_ |