SCOPe 2.08: Domain d6cqba1: 6cqb A:10-236

Lineage for d6cqba1 (6cqb A:10-236)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Piper methysticum [TaxId:130404] [350817] (2 PDB entries)

8. Domain d6cqba1: 6cqb A:10-236 [350820]
   automated match to d5wx4a1

Details for d6cqba1

PDB Entry: 6cqb, 2.91 Å

PDB Description: crystal structure of piper methysticum chalcone synthase

PDB Compounds: (A:) chalcone synthase

SCOPe Domain Sequences for d6cqba1:

Sequence; same for both SEQRES and ATOM records:

>d6cqba1 c.95.1.0 (A:10-236) automated matches {Piper methysticum [TaxId: 130404]}
aaqrargpatvlaigtaapanvvyqadypdyyfritksehmtelkekfrrmcdksmitkr
hmhlseellknnpdicaymapsldarqdmvvvevpklgkeaaakaikewgrpksaithli
fcttsgvdmpgadfqltkllglcpsvrrtmlyqqgcfaggtvlrlakdlaennagarvlv
vcseitavtfrgpsethldsmvgqalfgdgasaiivgadpdpvierp

Timeline for d6cqba1:

• d6cqba1 first appeared in SCOPe 2.07