| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
| Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [270905] (11 PDB entries) |
| Domain d6cx4a1: 6cx4 A:1-126 [350816] Other proteins in same PDB: d6cx4a3 automated match to d1plqa1 mutant |
PDB Entry: 6cx4 (more details), 3.08 Å
SCOPe Domain Sequences for d6cx4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cx4a1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl
Timeline for d6cx4a1: