Lineage for d6cx4a1 (6cx4 A:1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977029Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2977062Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [270905] (11 PDB entries)
  8. 2977069Domain d6cx4a1: 6cx4 A:1-126 [350816]
    Other proteins in same PDB: d6cx4a3
    automated match to d1plqa1
    mutant

Details for d6cx4a1

PDB Entry: 6cx4 (more details), 3.08 Å

PDB Description: v180a mutant of yeast pcna
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d6cx4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cx4a1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl

SCOPe Domain Coordinates for d6cx4a1:

Click to download the PDB-style file with coordinates for d6cx4a1.
(The format of our PDB-style files is described here.)

Timeline for d6cx4a1: