SCOPe 2.07: Domain d5icda_: 5icd A:

Lineage for d5icda_ (5icd A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)

7. Species Escherichia coli [TaxId:562] [53669] (27 PDB entries)

8. Domain d5icda_: 5icd A: [35080]
   complexed with ict, mg

Details for d5icda_

PDB Entry: 5icd, 2.5 Å

PDB Description: regulation of an enzyme by phosphorylation at the active site

PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d5icda_:

Sequence; same for both SEQRES and ATOM records:

>d5icda_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

Timeline for d5icda_:

• d5icda_ first appeared (with stable ids) in SCOP 1.55, called d5icd__
  
• d5icda_ appears in SCOPe 2.06
  
• d5icda_ appears in the current release, SCOPe 2.08