SCOPe 2.08: Domain d6fkld1: 6fkl D:2-245

Lineage for d6fkld1 (6fkl D:2-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)

8. Domain d6fkld1: 6fkl D:2-245 [350799]
   Other proteins in same PDB: d6fkla2, d6fklb2, d6fklc2, d6fkld2, d6fkle_, d6fklf1, d6fklf2, d6fklf3
   automated match to d4drxb1
   complexed with acp, ca, dlk, gdp, gol, gtp, mes, mg

Details for d6fkld1

PDB Entry: 6fkl, 2.1 Å

PDB Description: tubulin-tub015 complex

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6fkld1:

Sequence; same for both SEQRES and ATOM records:

>d6fkld1 c.32.1.1 (D:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d6fkld1:

• d6fkld1 first appeared in SCOPe 2.07