Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Phosphopantetheine adenylyltransferase [52398] (7 species) |
Species Escherichia coli [TaxId:562] [52399] (10 PDB entries) |
Domain d6ccla1: 6ccl A:2-159 [350793] Other proteins in same PDB: d6ccla2, d6cclb2 automated match to d1gn8a_ complexed with dms, exg, so4 |
PDB Entry: 6ccl (more details), 1.77 Å
SCOPe Domain Sequences for d6ccla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ccla1 c.26.1.3 (A:2-159) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps kewsfissslvkevarhqgdvthflpenvhqalmakla
Timeline for d6ccla1: