Lineage for d6ccla1 (6ccl A:2-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860491Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2860494Species Escherichia coli [TaxId:562] [52399] (10 PDB entries)
  8. 2860501Domain d6ccla1: 6ccl A:2-159 [350793]
    Other proteins in same PDB: d6ccla2, d6cclb2
    automated match to d1gn8a_
    complexed with dms, exg, so4

Details for d6ccla1

PDB Entry: 6ccl (more details), 1.77 Å

PDB Description: crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 1-benzyl-1h-imidazo[4,5-b]pyridine
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6ccla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ccla1 c.26.1.3 (A:2-159) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
kewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d6ccla1:

Click to download the PDB-style file with coordinates for d6ccla1.
(The format of our PDB-style files is described here.)

Timeline for d6ccla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ccla2