Lineage for d1gro__ (1gro -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.77: Isocitrate & isopropylmalate dehydrogenases [53658] (1 superfamily) Superfamily c.77.1: Isocitrate & isopropylmalate dehydrogenases [53659] (1 family) 
Family c.77.1.1: Isocitrate & isopropylmalate dehydrogenases [53660] (2 proteins) Protein Isocitrate dehydrogenase, ICDH [53668] (2 species) 
Species Escherichia coli [TaxId:562] [53669] (23 PDB entries) 
Domain d1gro__: 1gro - [35079]
Details for d1gro__
PDB Entry: 1gro (more details), 2.5 Å
PDB Description: regulatory and catalytic mechanisms in escherichia coli isocitrate dehydrogenase: multiple roles for n115
SCOP Domain Sequences for d1gro__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gro__ c.77.1.1 (-) Isocitrate dehydrogenase, ICDH {Escherichia coli}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirellvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
mgvkkirfpdhcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
SCOP Domain Coordinates for d1gro__:
Click to download the PDB-style file with coordinates for d1gro__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gro__:
- d1gro__ first appeared (with stable ids) in SCOP 1.55
- d1gro__ appears in SCOP 1.59
- d1gro__ appears in the current release, SCOPe 2.08, called d1groa_
View in 3D