SCOP 1.63: Domain d8icd__: 8icd -

Lineage for d8icd__ (8icd -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenases [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudodyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenases [53659] (2 families)

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
   the active site is between the two identical subunits

6. Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)

7. Species Escherichia coli [TaxId:562] [53669] (23 PDB entries)

8. Domain d8icd__: 8icd - [35076]
   complexed with ict, mg; mutant

Details for d8icd__

PDB Entry: 8icd, 2.5 Å

PDB Description: regulation of an enzyme by phosphorylation at the active site

SCOP Domain Sequences for d8icd__:

Sequence; same for both SEQRES and ATOM records:

>d8icd__ c.77.1.1 (-) Isocitrate dehydrogenase, ICDH {Escherichia coli}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirelnvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

Timeline for d8icd__:

• d8icd__ first appeared (with stable ids) in SCOP 1.55
  
• d8icd__ appears in SCOP 1.61
  
• d8icd__ appears in SCOP 1.65
  
• d8icd__ appears in the current release, SCOPe 2.08, called d8icda_