![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
![]() | Domain d6ey6i1: 6ey6 I:1-111 [350753] Other proteins in same PDB: d6ey6i2, d6ey6j2, d6ey6k2, d6ey6l2, d6ey6m2, d6ey6n2, d6ey6o2, d6ey6p2 automated match to d4w81a_ |
PDB Entry: 6ey6 (more details), 2.1 Å
SCOPe Domain Sequences for d6ey6i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ey6i1 b.1.1.1 (I:1-111) automated matches {Llama (Lama glama) [TaxId: 9844]} qvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihy adsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkydyw gqgtkvtv
Timeline for d6ey6i1: