![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.0: automated matches [191482] (1 protein) not a true family |
![]() | Protein automated matches [190772] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries) |
![]() | Domain d6fi0c_: 6fi0 C: [350747] automated match to d4q6fa_ complexed with dew, gol, k, po4, zn |
PDB Entry: 6fi0 (more details), 1.9 Å
SCOPe Domain Sequences for d6fi0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fi0c_ g.50.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqq
Timeline for d6fi0c_: