SCOPe 2.07: Domain d6fxnp2: 6fxn P:108-211

Lineage for d6fxnp2 (6fxn P:108-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6fxnp2: 6fxn P:108-211 [350734]
   Other proteins in same PDB: d6fxna_, d6fxnb_, d6fxnc_, d6fxne1, d6fxng1, d6fxni1, d6fxnj_, d6fxnk_, d6fxnl_, d6fxnn1, d6fxnp1, d6fxnr1
   automated match to d4ocrl2

Details for d6fxnp2

PDB Entry: 6fxn, 2.9 Å

PDB Description: crystal structure of human baff in complex with fab fragment of anti- baff antibody belimumab

PDB Compounds: (P:) belimumab light chain

SCOPe Domain Sequences for d6fxnp2:

Sequence; same for both SEQRES and ATOM records:

>d6fxnp2 b.1.1.2 (P:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttps
kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d6fxnp2:

• d6fxnp2 is new in SCOPe 2.07-stable
  
• d6fxnp2 appears in the current release, SCOPe 2.08