Lineage for d6ey6o1 (6ey6 O:2-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743908Domain d6ey6o1: 6ey6 O:2-111 [350727]
    Other proteins in same PDB: d6ey6i2, d6ey6j2, d6ey6k2, d6ey6l2, d6ey6m2, d6ey6n2, d6ey6o2, d6ey6p2
    automated match to d4w81a_

Details for d6ey6o1

PDB Entry: 6ey6 (more details), 2.1 Å

PDB Description: c-terminal part (residues 315-516) of porm with the llama nanobody nb130
PDB Compounds: (O:) nb130

SCOPe Domain Sequences for d6ey6o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ey6o1 b.1.1.1 (O:2-111) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihya
dsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkydywg
qgtkvtv

SCOPe Domain Coordinates for d6ey6o1:

Click to download the PDB-style file with coordinates for d6ey6o1.
(The format of our PDB-style files is described here.)

Timeline for d6ey6o1: