Lineage for d6ft2a_ (6ft2 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2522032Protein automated matches [190140] (38 species)
    not a true protein
  7. 2522309Species Salmonella typhimurium [TaxId:90371] [350723] (1 PDB entry)
  8. 2522310Domain d6ft2a_: 6ft2 A: [350724]
    automated match to d1lsta_
    complexed with arg, cl, edo

Details for d6ft2a_

PDB Entry: 6ft2 (more details), 1.25 Å

PDB Description: structure of the periplasmic binding protein lao-q122a in complex with arginine.
PDB Compounds: (A:) Lysine/arginine/ornithine-binding periplasmic protein

SCOPe Domain Sequences for d6ft2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ft2a_ c.94.1.1 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
lpqtvrigtdttyapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipslka
kkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgst
aeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyafa
gpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvyg

SCOPe Domain Coordinates for d6ft2a_:

Click to download the PDB-style file with coordinates for d6ft2a_.
(The format of our PDB-style files is described here.)

Timeline for d6ft2a_: