Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein automated matches [190140] (38 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [350723] (1 PDB entry) |
Domain d6ft2a_: 6ft2 A: [350724] automated match to d1lsta_ complexed with arg, cl, edo |
PDB Entry: 6ft2 (more details), 1.25 Å
SCOPe Domain Sequences for d6ft2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ft2a_ c.94.1.1 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]} lpqtvrigtdttyapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipslka kkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgst aeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyafa gpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvyg
Timeline for d6ft2a_: