SCOPe 2.08: Domain d6fi1a1: 6fi1 A:1928-1983

Lineage for d6fi1a1 (6fi1 A:1928-1983)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)

8. Domain d6fi1a1: 6fi1 A:1928-1983 [350718]
   Other proteins in same PDB: d6fi1a2, d6fi1b2
   automated match to d4q6fa_
   complexed with d3h, zn

Details for d6fi1a1

PDB Entry: 6fi1, 2.7 Å

PDB Description: crystal structure of human baz2b phd zinc finger in complex with fr23

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d6fi1a1:

Sequence; same for both SEQRES and ATOM records:

>d6fi1a1 g.50.1.0 (A:1928-1983) automated matches {Human (Homo sapiens) [TaxId: 9606]}
simkvycqicrkgdneellllcdgcdkgchtychrpkittipdgdwfcpaciakas

Timeline for d6fi1a1:

• d6fi1a1 first appeared in SCOPe 2.07