SCOPe 2.07: Domain d6faeb1: 6fae B:18-177

Lineage for d6faeb1 (6fae B:18-177)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Human (Homo sapiens), ARL1 [TaxId:9606] [102364] (4 PDB entries)

8. Domain d6faeb1: 6fae B:18-177 [350716]
   Other proteins in same PDB: d6faeb2
   automated match to d1upta_
   complexed with edo

Details for d6faeb1

PDB Entry: 6fae, 2.35 Å

PDB Description: the sec7 domain of iqsec2 (brag1) in complex with the small gtpase arf1

PDB Compounds: (B:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d6faeb1:

Sequence, based on SEQRES records:

>d6faeb1 c.37.1.8 (B:18-177) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnql

Sequence, based on observed residues (ATOM records):

>d6faeb1 c.37.1.8 (B:18-177) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}
mrilmvgldaagkttilyklktiptigfnvetveyknisftvwdvggqdkirplwrhyfq
ntqglifvvdsndrervneareelmrmlaedelrdavllvfankqnamnaaeitdklglh
slrhrnwyiqatcatsgdglyegldwlsnql

Timeline for d6faeb1:

• d6faeb1 is new in SCOPe 2.07-stable