![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
![]() | Family d.58.11.0: automated matches [254210] (1 protein) not a true family |
![]() | Protein automated matches [254469] (4 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [350693] (1 PDB entry) |
![]() | Domain d6fswa3: 6fsw A:164-236 [350694] Other proteins in same PDB: d6fswa1, d6fswa2 automated match to d1p9qc3 complexed with peg |
PDB Entry: 6fsw (more details), 1.9 Å
SCOPe Domain Sequences for d6fswa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fswa3 d.58.11.0 (A:164-236) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} eemeiaikippehtgraisalynfggvtreewqrdgswicvmripsgmygdlmdllgkva kgealtkvlrrig
Timeline for d6fswa3: