Lineage for d6fswa3 (6fsw A:164-236)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953573Family d.58.11.0: automated matches [254210] (1 protein)
    not a true family
  6. 2953574Protein automated matches [254469] (4 species)
    not a true protein
  7. 2953575Species Archaeoglobus fulgidus [TaxId:2234] [350693] (1 PDB entry)
  8. 2953576Domain d6fswa3: 6fsw A:164-236 [350694]
    Other proteins in same PDB: d6fswa1, d6fswa2
    automated match to d1p9qc3
    complexed with peg

Details for d6fswa3

PDB Entry: 6fsw (more details), 1.9 Å

PDB Description: structure of archaeoglobus fulgidus sbds protein at 1.9 angstrom
PDB Compounds: (A:) Ribosome maturation protein SDO1-like protein

SCOPe Domain Sequences for d6fswa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fswa3 d.58.11.0 (A:164-236) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
eemeiaikippehtgraisalynfggvtreewqrdgswicvmripsgmygdlmdllgkva
kgealtkvlrrig

SCOPe Domain Coordinates for d6fswa3:

Click to download the PDB-style file with coordinates for d6fswa3.
(The format of our PDB-style files is described here.)

Timeline for d6fswa3: