SCOPe 2.08: Domain d6fswa2: 6fsw A:89-163

Lineage for d6fswa2 (6fsw A:89-163)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.8: Hypothetical protein AF0491, middle domain [109728] (2 families)

5. Family a.5.8.0: automated matches [254275] (1 protein)
   not a true family

6. Protein automated matches [254640] (2 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [350691] (1 PDB entry)

8. Domain d6fswa2: 6fsw A:89-163 [350692]
   Other proteins in same PDB: d6fswa1, d6fswa3
   automated match to d1p9qc1
   complexed with peg

Details for d6fswa2

PDB Entry: 6fsw, 1.9 Å

PDB Description: structure of archaeoglobus fulgidus sbds protein at 1.9 angstrom

PDB Compounds: (A:) Ribosome maturation protein SDO1-like protein

SCOPe Domain Sequences for d6fswa2:

Sequence; same for both SEQRES and ATOM records:

>d6fswa2 a.5.8.0 (A:89-163) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
itaeqrremleakrkqiinfisrntidprtnaphppsrieraleeakvhidifksveaqv
kdivkalkpilplkf

Timeline for d6fswa2:

• d6fswa2 first appeared in SCOPe 2.07