![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.235: FYSH domain [89894] (1 superfamily) beta(2)-alpha(2)-beta(2)-alpha-beta; two layers: alpha/beta; antiparallel sheet: order 51234 |
![]() | Superfamily d.235.1: FYSH domain [89895] (3 families) ![]() |
![]() | Family d.235.1.0: automated matches [254274] (1 protein) not a true family |
![]() | Protein automated matches [254639] (2 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [350689] (1 PDB entry) |
![]() | Domain d6fswa1: 6fsw A:5-88 [350690] Other proteins in same PDB: d6fswa2, d6fswa3 automated match to d1p9qc2 complexed with peg |
PDB Entry: 6fsw (more details), 1.9 Å
SCOPe Domain Sequences for d6fswa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fswa1 d.235.1.0 (A:5-88) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} sldkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgerasvde lrkifgtddvfeiarkiilegevq
Timeline for d6fswa1: