SCOPe 2.08: Domain d6fe4i1: 6fe4 I:6-119

Lineage for d6fe4i1 (6fe4 I:6-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d6fe4i1: 6fe4 I:6-119 [350678]
   Other proteins in same PDB: d6fe4a1, d6fe4a2, d6fe4b1, d6fe4b2, d6fe4c1, d6fe4c2, d6fe4d_, d6fe4e1, d6fe4e2, d6fe4f2, d6fe4g2, d6fe4h2, d6fe4i2, d6fe4j2
   automated match to d6eqib_

Details for d6fe4i1

PDB Entry: 6fe4, 3 Å

PDB Description: crystal structure of the complex between shiga toxin stx2 b subunit and neutralising nb113

PDB Compounds: (I:) Nb113

SCOPe Domain Sequences for d6fe4i1:

Sequence; same for both SEQRES and ATOM records:

>d6fe4i1 b.1.1.1 (I:6-119) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqpggslrlscaasgftfssyymswvrqapgkgpewvsgintggvgtryadsvk
grftisrdnakntlylqmnslkpedtalyycaigeggnrnywgqgtqvtvsshh

Timeline for d6fe4i1:

• d6fe4i1 first appeared in SCOPe 2.07