Lineage for d6fk8a_ (6fk8 A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. Family f.13.1.2: Rhodopsin-like [81320] (2 proteins)
    Individual TM segments have a number of kinks and distortions
  6. Protein automated matches [190300] (1 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [188510] (18 PDB entries)
  8. Domain d6fk8a_: 6fk8 A: [350671]
    automated match to d1l9ha_
    complexed with bog, dnz, plm

Details for d6fk8a_

PDB Entry: 6fk8 (more details), 2.8699999999999997 Å

PDB Description: crystal structure of n2c/d282c stabilized opsin bound to rs08
PDB Compounds: (A:) rhodopsin

SCOPe Domain Sequences for d6fk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fk8a_ f.13.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mcgtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgscfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgkn

SCOPe Domain Coordinates for d6fk8a_ are not available.

Timeline for d6fk8a_: