SCOP 1.69: Domain d1ai2__: 1ai2 -

Lineage for d1ai2__ (1ai2 -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
   the active site is between the two identical subunits

6. Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)

7. Species Escherichia coli [TaxId:562] [53669] (26 PDB entries)

8. Domain d1ai2__: 1ai2 - [35067]

Details for d1ai2__

PDB Entry: 1ai2, 1.9 Å

PDB Description: isocitrate dehydrogenase complexed with isocitrate, nadp+, and calcium (flash-cooled)

SCOP Domain Sequences for d1ai2__:

Sequence; same for both SEQRES and ATOM records:

>d1ai2__ c.77.1.1 (-) Isocitrate dehydrogenase, ICDH {Escherichia coli}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

Timeline for d1ai2__:

• d1ai2__ first appeared (with stable ids) in SCOP 1.55
  
• d1ai2__ appears in SCOP 1.67
  
• d1ai2__ appears in SCOP 1.71
  
• d1ai2__ appears in the current release, SCOPe 2.08, called d1ai2a_