Lineage for d6f9ua_ (6f9u A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963862Family d.92.1.5: Neurolysin-like [55505] (5 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 2963899Protein Angiotensin converting enzyme, ACE [82733] (2 species)
    M2 family member; overall fold is similar to that of neurolysin but is less elaborated
  7. 2963907Species Human (Homo sapiens) [TaxId:9606] [82734] (17 PDB entries)
    Uniprot P22966
  8. 2963912Domain d6f9ua_: 6f9u A: [350665]
    automated match to d4c2oa_
    complexed with 1pe, bo3, cl, d0w, edo, imd, nag, peg, zn

Details for d6f9ua_

PDB Entry: 6f9u (more details), 1.9 Å

PDB Description: crystal structure of human testis angiotensin-1 converting enzyme in complex with sampatrilat-asp.
PDB Compounds: (A:) angiotensin-converting enzyme

SCOPe Domain Sequences for d6f9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f9ua_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Human (Homo sapiens) [TaxId: 9606]}
deaeaskfveeydrtsqvvwneyaganwnyntnittetskillqknmqiaqhtlkygtqa
rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpqgscl
qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwqks
mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
alreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkiafip
fsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvp
yiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamq
litgqpqmsasamlsyfkplldwlrtenelhgeklgwpqynwtpns

SCOPe Domain Coordinates for d6f9ua_:

Click to download the PDB-style file with coordinates for d6f9ua_.
(The format of our PDB-style files is described here.)

Timeline for d6f9ua_: