Lineage for d6ff5a_ (6ff5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691317Protein automated matches [190113] (17 species)
    not a true protein
  7. 2691318Species Cow (Bos taurus) [TaxId:9913] [187444] (2 PDB entries)
  8. 2691320Domain d6ff5a_: 6ff5 A: [350664]
    automated match to d2b4za_
    complexed with hec, no3, so4

Details for d6ff5a_

PDB Entry: 6ff5 (more details), 1.74 Å

PDB Description: x-ray structure of bovine heart cytochrome c at high ionic strength
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d6ff5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ff5a_ a.3.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgfsytdanknkgitwg
eetlmeylenpkkyipgtkmifagikkkgeredliaylkkatne

SCOPe Domain Coordinates for d6ff5a_:

Click to download the PDB-style file with coordinates for d6ff5a_.
(The format of our PDB-style files is described here.)

Timeline for d6ff5a_: