![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
![]() | Domain d6fe4f1: 6fe4 F:6-117 [350641] Other proteins in same PDB: d6fe4a1, d6fe4a2, d6fe4b1, d6fe4b2, d6fe4c1, d6fe4c2, d6fe4d_, d6fe4e1, d6fe4e2, d6fe4f2, d6fe4g2, d6fe4h2, d6fe4i2, d6fe4j2 automated match to d6eqib_ |
PDB Entry: 6fe4 (more details), 3 Å
SCOPe Domain Sequences for d6fe4f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fe4f1 b.1.1.1 (F:6-117) automated matches {Vicugna pacos [TaxId: 30538]} esggglvqpggslrlscaasgftfssyymswvrqapgkgpewvsgintggvgtryadsvk grftisrdnakntlylqmnslkpedtalyycaigeggnrnywgqgtqvtvss
Timeline for d6fe4f1: