Lineage for d1cm7b_ (1cm7 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1386088Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1386089Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1386090Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1386091Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (10 species)
  7. 1386098Species Escherichia coli [TaxId:562] [53667] (1 PDB entry)
  8. 1386100Domain d1cm7b_: 1cm7 B: [35064]

Details for d1cm7b_

PDB Entry: 1cm7 (more details), 2.06 Å

PDB Description: 3-isopropylmalate dehydrogenase from escherichia coli
PDB Compounds: (B:) protein (3-isopropylmalate dehydrogenase)

SCOPe Domain Sequences for d1cm7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cm7b_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Escherichia coli [TaxId: 562]}
msknyhiavlpgdgigpevmtqalkvldavrnrfamrittshydvggaaidnhgqplppa
tvegceqadavlfgsvggpkwehlppdqqpergallplrkhfklfsnlrpaklyqgleaf
cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf
esarkrrhkvtsidkanvlqssilwreivneiateypdvelahmyidnatmqlikdpsqf
dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia
qilslalllrysldaddaacaierainraleegirtgdlargaaavstdemgdiiaryva
egv

SCOPe Domain Coordinates for d1cm7b_:

Click to download the PDB-style file with coordinates for d1cm7b_.
(The format of our PDB-style files is described here.)

Timeline for d1cm7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cm7a_