SCOPe 2.08: Domain d1cm7a_: 1cm7 A:

Lineage for d1cm7a_ (1cm7 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)

7. Species Escherichia coli [TaxId:562] [53667] (1 PDB entry)

8. Domain d1cm7a_: 1cm7 A: [35063]

Details for d1cm7a_

PDB Entry: 1cm7, 2.06 Å

PDB Description: 3-isopropylmalate dehydrogenase from escherichia coli

PDB Compounds: (A:) protein (3-isopropylmalate dehydrogenase)

SCOPe Domain Sequences for d1cm7a_:

Sequence; same for both SEQRES and ATOM records:

>d1cm7a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Escherichia coli [TaxId: 562]}
msknyhiavlpgdgigpevmtqalkvldavrnrfamrittshydvggaaidnhgqplppa
tvegceqadavlfgsvggpkwehlppdqqpergallplrkhfklfsnlrpaklyqgleaf
cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf
esarkrrhkvtsidkanvlqssilwreivneiateypdvelahmyidnatmqlikdpsqf
dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia
qilslalllrysldaddaacaierainraleegirtgdlargaaavstdemgdiiaryva
egv

Timeline for d1cm7a_:

• d1cm7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cm7a_ appears in SCOPe 2.07