SCOPe 2.08: Domain d6fahd2: 6fah D:228-379

Lineage for d6fahd2 (6fah D:228-379)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Acetobacterium woodii [TaxId:931626] [350569] (1 PDB entry)

8. Domain d6fahd2: 6fah D:228-379 [350629]
   Other proteins in same PDB: d6fahb_, d6fahc1, d6fahd1, d6fahf_
   automated match to d2d29a1
   complexed with fad, sf4, so4

Details for d6fahd2

PDB Entry: 6fah, 3.13 Å

PDB Description: molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction

PDB Compounds: (D:) Caffeyl-CoA reductase-Etf complex subunit CarC

SCOPe Domain Sequences for d6fahd2:

Sequence; same for both SEQRES and ATOM records:

>d6fahd2 a.29.3.0 (D:228-379) automated matches {Acetobacterium woodii [TaxId: 931626]}
nkgfsnamktldvgrlgvasqsigvaqgaldeaikyakerkqfgkriadfqaiafmiadm
atkleaakllvynaaslmdnkknatkeasmakfyaseicneicakavqihggygyikeyk
vermyrdcrvftiyegtsqvqqmvisgmllkk

Timeline for d6fahd2:

• d6fahd2 first appeared in SCOPe 2.07